<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU582-09 CU582-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A, L90M L33F T4H, L5S, L10I, N37ND, R41RK, K55R, R57K, L63P, A71V, V77I, I93L, C95F  
>CU582-09| codons 1-99
PQIHSWQRPIVTIKIGGQLKEALLDTGADDTVFEEMDLPGKWKPKLIGGIGGFMRVKQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012