<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1163-09 CU1163-09 Cuba 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, L90M   I13V, G16E, K20I, E35N, R41K, H69K, K70KR, L89M M36IR
>CU1163-09| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLENRNLPGKWKPKLIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012