<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1629-09 CU1629-09 Cuba 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V K219E K103N, Y181C V108I K49R, E53D, D123E, E169D, I178L, Q207E, R211K, F214L, L228R, V245Q, I329L Q182QP, Y319YH
>CU1629-09| codons 1-342
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPDNPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
CPYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDEKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYHDPSKDLIAELQKQGQGQWTYQIY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IL, Q18L, L19I, E35D, M36I, I62V, L63P, H69Q, I72V  
>CU1629-09| codons 1-99
PQITLWQRPLVTIKLGGLIKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGQKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012