<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184MIV K219Q G190GA K101H I5IV, V35VI, V60VI, K64R, K122E, S162SC, I178IM, Q197QK, T200TAIV, D237DN, V245VL, E248ED, A272AP, V276VAIT, K277KR, T286TA, E291EK, V292VI, E297EA, E300EK P157PL
>CU147-10| codons 1-343
PISPVETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIRKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSLAIFQCSMTKILEPFRKQNPDMVI
YQYVDDLYVASDLEIGKHRVKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPNKWT
VQPILLPDKDSWTVNDIQKLVGKLNWASQIYPGIKTRQLCKLLRGAKALTKIIPLTAEAK
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50IV, L90LM   L10IV, I13IV, K14R, Q18QR, M36MI, N37NS, D60DE, L63LP, A71AV, L89LM  
>CU147-10| codons 1-99
PQITLWQRPVVTVRIGGRLKEALLDTGADDTVLEEISLPGRWKPKIIGGVGGFIKVRQYE
QIPIEICGHKVIGTVLVGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012