<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103N   V35IMT, E40D, V60I, S162C, D177E, I178L, V179I, T200S, I202IV, Q207E, R211K, V245T, K249KQ, D250E, A272P, K277KR, T286AP, V292VI, I293IV, P294PT, E297R, L301I, P313AS, V317A, I329V, G335D L12F, Q161QR
>CU1673-09| codons 1-348
PISPIETVPVKFKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFRCSMTKILEPFRKQNPELII
YQYVDDLYVGSDLEIGQHRSKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEQESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGPKALTEIVTLTREAE
IELAENREILKESVHGAYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, M36I, N37ND, R41K, D60E, I62V, L63P, H69Q  
>CU1673-09| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYE
QVPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012