<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1462-10 CU1462-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, M36ML, N37S, P39PS, I62V, L63H, I64V  
>CU1462-10| codons 1-99
PQITLWQRPLVTVKIEGQLKEALLDTGADDTVLEELSLSGRWKPKMIGGIGGFIKVRQYD
QVHVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   P4PH, E44ED, K49R, D123E, I135IT, T165TILP, E169D, D177E, I178L, Q207E, R211RK, F214L, L228LR, V245M, A272P, K311R, I329L, G335S  
>CU1462-10| codons 1-340
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKDGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMPKILDPFRKQNPELVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAELQKQGQSQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012