<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU112-11 CU112-11 Cuba 2011 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219E K103S, G190GA   V35I, S48T, E53D, V60VI, S68G, K101R, D123E, I135T, K166R, G196E, R211K, A272P, E297R, I329V, G333E  
>CU112-11| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKITKIGPDNPYNTPI
FAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKSKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVASDLEIEQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQEQGQWTYQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54V, V82A   L10V, T12V, I15V, K20R, E35D, M36I, N37D, R41K, L63P, T91TS  
>CU112-11| codons 1-99
PQITLWQRPVVVIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLSQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012