<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU35-10 CU35-10 Cuba 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82T   L10I, I13V, K20IM, E35D, M36I, N37D, R41K, Q61N, C67Y, H69K, T74S, L89M  
>CU35-10| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYD
NILIEIYGKKAIGSVLVGPTPTNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   I135T, S162C, I178IM, Q197K, T200A, R211S, W212G, V245Q, E248D, A272P, K277R, V292I, I293V, E297A, P321S, D324DE  
>CU35-10| codons 1-340
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGKHRAKIEELRQHLLSGGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDSSKELIAEIQKQGQGQWTYQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012