<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1165 CA2648 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDC 52
3 D4T 52
4 3TC+AZT+SQV 48
5 3TC+AZT+NFV 13
6 3TC+AZT+IDV+NVP 20
7 3TC+AZT+DLV+RTV+SQV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A   L10I, T12P, K14R, E35D, N37D, L63P, C67D  
>CA2648| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIVGIGGFVKVRQYD
QIPIEIDGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005