<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1383-10 CU1383-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82C, L90M   L10I, E34K, R41K, I62V, L63H, H69Y, A71V, I72V, V77I, I93L  
>CU1383-10| codons 8-99
RPIVTIKIGGQLKEALLDTGADDTVLKEMNLPGKWKPKMIVGIGGFVKVRQYDQVHIEIC
GYKVVGTVLIGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, L74V, M184V, L210W, T215Y   Y181I   K122E, I142T, T165L, D177E, V179I, G196E, I202V, Q207E, R211K, L228H, K277R, T286A, A288S, P294T, E297R, K311R, Q334L  
>CU1383-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMLKILEPFRKQNPEIII
IQYVDDLYVGSDLEIEQHRTKVEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVITLTREAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGLG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012