<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, L74I   L100I, K103N   V35I, T39TA, V60I, W88G, A98P, S117T, D121N, K122E, D123S, F124L, I135V, Y144F, A272P, K281R, V292I, I293V, E297Q A114P, T128S, N147M
>CU294-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPI
FAIKKKDSDRWRKIVDFRELNKRTQDFGEVQLGIPHPPGIKKNKSVTVLDVGDPYFTVPL
NESLRKYSAFTIPSVNNETPGIRFQYMVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEIVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V Q58E, L89V I13A, L19P, K20I, A22V, L33V, E35D, M36I, N37D, I62IV, L63P, I66F, H69K, A71V, T74A, Q92K, I93IV  
>CU294-10| codons 1-99
PQITLWQRPLVTAKIGGQPIEVLLDTGADDTVVEDIDLPGRWKPKLIGGIGGFVKVREYD
QVPIEFCGKKVIGAVLVGPTPVNVIGRNVLTKVGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012