<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU345-10 CU345-10 Cuba 2010 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VA   W6G, L10I, K20R, E35D, M36I, R41K, Q61DN, L63P, H69Q, K70T, I93L  
>CU345-10| codons 1-99
PQITLGQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
NIPIEICGQTAIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215I, K219Q     V35IT, E40ED, K49R, V60I, V90VI, K122E, E169D, D177E, R211K, V245K, D250E, A272P, T286A, I329V  
>CU345-10| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFITPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQ

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012