<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1389-10 CU1389-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N K238T K20KR, K49R, K122KE, D123E, I135T, S162C, E169D, D177E, I178L, V189I, T200A, Q207E, F214L, V245M, A272P, V276I, L283I, I293V, S322E, I329L  
>CU1389-10| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPELVI
YQYVDDLYIGSDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDTWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPEKDLIAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M N88D I13V, N37S, R41K, L63PS, I64V, A71V, V77I  
>CU1389-10| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QISVEICGHKVIGTVLIGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012