<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU459-10 CU459-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39A, K49R, S68G, D123E, S162D, E169D, I178L, V179I, Q207E, R211RK, V245M, A272P, P313Q, I326V, I329L  
>CU459-10| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILDPFRKQNPDLII
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEQVHGVYYDPSKDLVAELQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, Q58E T4P, L10I, I13V, G16E, K20R, E35D, M36I, L63H, K70E, A71V, I72T, I93M  
>CU459-10| codons 1-99
PQIPLWQRPIVTVKIEGQLREALLDTGADDTIFEDINLPGRWTPKIVGGIGGFMKVREYD
QIHIEICGHEVTGTVLVGPTPANIIGRNLMTQMGCTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012