<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU1692-10 CU1692-10 Cuba 2010 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12P, I13V, K14R, K20I, E35D, M36I, L63P, C67S, H69Q, V82I, L89M  
>CU1692-10| codons 1-99
PQITLWQRPIVPVRIGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEISGQKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181YC   K122E, D123DE, I135R, S162SC, D177E, Q197E, I202V, R211K, V245E, E248D, A272P, K277R, T286A, V292I, E297A, V317A W266G
>CU1692-10| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGEHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDSWTVNDIQKLVGKLNGASQIYPGIKVRQLCKLLRGAKALTEIIPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012