<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU377-10 CU377-10 Cuba 2010 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   G190A   K49R, V118I, D121Y, K122E, I135T, E169D, D177E, I178L, V179I, Q207E, R211K, F214L, V245M, A272P, I293IV, I329L P59Q
>CU377-10| codons 1-342
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTQV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPELII
YQYVDDLYVASDLEIGQHRTKIEELREHLLKWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, I13V, K20R, M36I, I62V, L63P, H69Q, A71V, I72L, I93L, C95F  
>CU377-10| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGQKVLGTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Kouri, V High frequency of antiviral drug resistance and non-B subtypes in HIV-1 patients failing antiviral therapy in Cuba. J Clin Virol, 2012