<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, L210W, T215Y V75M K103N V108VI, K238T S3C, K11A, V35T, T39K, K43KE, E44ED, K122E, D123N, I135T, I142V, E169D, K173A, Q174K, D177E, I178L, Q207A, R211NS, V245Q, A272P, L283I, T286A, E291D, I293V, E297R, E312D, G335D, R356K, M357R, R358S, G359S, E370Q, A371V, I375V, S379C, K390R, E399D, A400T, T403M  
>HJ3121| codons 1-429
PICPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRAKNPELVI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLWSWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDVVPLTREAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRSSA
HTNDVKQLTQVVQKVATECIVIWGKTPKFRLPIQKETWDTWWMEYWQATWIPEWEFVNTP
PLVKLWYQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, K20R, E35D, M36I, N37D, R41K, L63P, E65D, H69K, K70R, L89M  
>HJ3121| codons 1-99
PQITLWQRPVVTVKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIDICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Aghokeng, AF Virological outcome and patterns of HIV-1 drug resistance in patients with 36 months' antiretroviral therapy experience in Cameroon. J Int AIDS Soc, 2013