<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
S1119066 S1119066 Cambodia 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75M     V35T, T39K, K43E, K82KR, A98S, V118I, K122E, D123S, A158S, K173A, Q174K, D177E, I178M, V179I, Q207A, R211S, K238R  
>S1119066| codons 25-239
PLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNRRT
QDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPSIFQSSMTKILEPFRAKNPEMIIYQYMDDLYVGSDLEIGQHRTKIEE
LRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014