<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T0807129 T0807129 Cambodia 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, L76V, V82F Q58E L10I, I13V, G16E, K20I, E35DN, M36I, N37ND, K55R, L63T, I64V, H69K, I72T, L89M  
>T0807129| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLENIDLPGRWKPKIVGGIGGFIRVREYD
QITVEICGKKATGTVVVGPTPFNIIGRNMLTQIGCTLNF

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014