<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, M184V A62V, V75I, F77L K101E, Y181C, G190A V108I V35T, T39K, E40K, K43E, K49R, T58S, S68R, K122E, D123S, I135T, S162C, T165I, D177E, I178M, T200I, I202V, Q207N F116P, V118T
>Q0518305| codons 23-239
QWPLTEEKIKALTEICKKMEEEGKISRIGPENPYNSPVFVIKKKDRTEWRKLIDLRELNK
RTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYPSTPLDESFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQCSMIKILEPFRKQNPEMVICQYVDDLYVASDLEIGQHRIKV
EELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014