<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R V75T, K219R K103N, Y181C, G190A   V35T, T39E, S68G, V106I, K122E, D123S, I132L, I142V, K173I, Q174K, D177E, I178M, V179I, Q207A, R211S, F214L, H221Y, L228LR, K238R I63L, P140T
>R0917161| codons 16-239
MDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPVFALKRKDGTKWRKLT
DFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSVPLDESFRKYTAFTLPSI
NNETTGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMIICQYMDDLYVASDLEI
GQHRTKIEELRAHLLSWGLTTPDRKYQKEPPFRWMGYELHPDRW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014