<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y K70N, V75T, K219N Y181C V108I K20R, V35T, T39E, T69N, K102Q, V118I, K122E, D123S, S162T, K173V, Q174K, D177E, I178L, V179I, G196A, T200A, E203D, Q207A, R211A, H221Y  
>S0822156| codons 19-239
PRVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPVFAIKKKNSNNWRKLTDFR
ELNKRTQDFWEVQLGIPHPAGLKQKKSVTILDVGDAYFSIPLDESFRKYTAFTIPSINNE
TPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRVKNPELIICQYMDDLYVGSDLEIAQH
RAKIDELRAHLLAWGFYTPDNKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014