<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T0929127 T0929127 Cambodia 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V, T215F V75M K103N, Y181C   E28Q, V35T, T39D, S105T, K122E, D123S, I135T, K173T, Q174K, D177E, I178M, T200A, Q207A, R211S, K238R E29K
>T0929127| codons 17-239
DGPKVKQWPLTQKKIKALTEICDEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVMD
FRELNKRTQDFWEVQLGIPHPAGLKKNKTVTVLDVGDAYFSVPLDESFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVICQYVDDLYVGSDLEIG
QHRAKIEELRAHLLSWGFFTPDKKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014