<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T0630085 T0630085 Cambodia 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V V75M, K219Q K103N, Y181C   V35T, T39K, K43E, V60I, T69N, K173IR, Q174K, D177E, G196E, Q207S, R211S, K238R  
>T0630085| codons 16-239
MDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPIFAIKKKNSNKWRKIM
DFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIVICQYVDDLYVGSDLEI
EQHRTKIEELRSHLLSWGFTTPDQKHQKEPPFLWMGYELHPDRW

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014