<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5 5 Cambodia 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA
2 LPV+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6R, Q18R, K20R, E35D, M36I, R41K, H69K, K70R, I72E, T80A, L89I, T91P V77E, L90W
>5| codons 1-99
PQITLRQRPLVTIKIGGRLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAEGTVLEGPAPVNIIGRNIWPQIGCTLNF

References
Author Title Citation
Nerrienet, E HIV-1 protease inhibitors resistance profiles patients virological failure LPV/r based 2nd line regimen Cambodia. unpublished, 2014