<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B1130 B1130 DRC 2011 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20I, E35D, M36I, L63C, I64M, C67S, H69K, V82I, L89M  
>B1130| codons 1-99
PQITLWQRPLVTVKVGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QICMEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013