<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10M, I13V, I15V, G17E, K20I, E35D, M36I, N37NI, R41K, K45KR, R57RK, L63P, E65Q, H69K, L89M  
>B1104| codons 1-99
PQITLWQRPMITVKVGEQLIEALLDTGADDTVLEDIILPGKWKPRMIGGIGGFIKVKQYD
QIPIQICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   K103N   V35R, T39A, S48T, V60VI, V118I, K122E, D123N, I135T, S162A, T165L, K173N, Q174K, T200A, E203G, Q207E, R211K, F214L, P243T, V245K, D250E  
>B1104| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMLKILEPFRNKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIGELREHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQTIKLPEKESWTVNDIQK

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013