<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y V75M Y181C A98G I31L, V35IT, T39A, E44D, V60I, K101Q, V106I, V118I, P119PS, D121C, K122E, S162N, Q174K, D177E, I178V, T200E, K201M, E203K, E204Q, Q207A, R211K, K223T, L228R, V245T  
>B1117| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKDSDKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLQKKKSITVLDVGDAYFSISL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKKNPEVVI
CQYVDDLYVGSDLEIGQHREMIKQLRAHLWKWGFYTPDKKHQTEPPFRWMGYELHPDKWT
VQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V, C67S, T74A  
>B1117| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEISGHKAIGAVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013