<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q K103N K238N K20R, E28A, V35T, T39N, V60I, A98S, K122E, D123N, I135T, K173A, D177E, T200A, Q207E, R211K, V245K H96HP, S191SF
>B1158| codons 1-257
PISPIETVPVKLKPGMDGPRVKQWPLTAEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPPPSGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGFDLEIGQHRAKIEELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDNWT
VQPIKLPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I L10M, I13A, L19V, K20I, M36I, R41K, L63V, H69K, K70KR, L89M  
>B1158| codons 1-99
PQITLWQRPMITAKIGGQVIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013