<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20L, E34T, E35D, M36I, N37E, P39A, K43R, Q61N, I62M, L63T, C67E, H69K, K70R, I72T, V77I, L89M D29DN
>B1145| codons 1-99
PQITLWQRPIVTVRIGGQLLEALLDTGANDTVLTDIELAGRWRPKMIGGIGGFIKVRQYD
NMTIEIEGKRATGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69DN, K70KR, M184V, T215TNSY   K101E, M230L V108I, F227L V35T, V60I, K122E, D123N, E138A, D177E, I178M, T200E, I202IV, Q207K, R211A, H221Y, L228LH, V245K  
>B1145| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHREKVEELRKHLLAWGFYTPDKKYQKEPPLHWLGYELHPDKWT
VQPIKLPEKDSWTV

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013