<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V, T215FY K219KN K101E, M230L A98G, V108I K22R, V35T, T39L, S68G, K104R, K122E, D123S, E138A, S162A, Q174K, T200A, E203D, Q207D, H221Y, V245Q  
>B1125| codons 1-262
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLEKKRSVTILDVGDAYFSVPL
DESFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIDELRDHLLRWGFYTPDNKYQKEPPFLWLGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14KR, G16E, K20I, M36I, L63S, H69K, I72M, L89M  
>B1125| codons 1-99
PQITLWQRPVVTVRIEGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013