<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, T39N, V60I, D121H, K122E, I135V, I142IV, K173R, Q174K, D177E, I178M, Q197E, T200A, Q207D, R211RK, V245Q S191SF
>B1156| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEMVI
YQYMDDLYVGFDLEIGEHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14G, I15V, K20I, E35EK, M36I, N37E, H69K, I72IM, L89M  
>B1156| codons 1-99
PQITLWQRPLVTVGVGGQLIEALLDTGADDTVLEKIELPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013