<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA
2 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, L210W, T215Y   K103N A98G, V108I K20R, V35T, E36D, T39LS, K43KE, V60VI, L109LI, D123E, I135T, S162AT, K173T, Q174K, N175NY, D177E, G196E, T200A, Q207E, R211K, V245Q  
>B1137| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICSELEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTIIDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRTKYPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L5LF, L10V, I13V, G16E, K20I, M36I, P39AS, R41K, I64M, H69K, L89M  
>B1137| codons 1-99
PQITFWQRPVVTVKIEGQLIEALLDTGADDTVLEEINLSGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Pircher, M Molecular characterization of HIV type 1 in Brazzaville, Republic of Congo, and first data on resistance to antiretroviral drugs. ARHR, 2013