<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-349 SNA3-349 Senegal 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I   Y181V L234LI V35T, E36D, I37IF, I47IF, V90I, K122E, D123N, I135V, S162A, T165I, K173T, Q174K, D177E, T200A, Q207E, R211K E233KN
>SNA3-349| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDFCTEMEKEGKFSKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEIVI
VQYIDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYNIHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, N37N_N, I62V, H69K, L89M  
>SNA3-349| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013