<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-234 SNA3-234 Senegal 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C A98G, V179E V35T, V60I, K102N, I135V, S162A, K173T, Q174N, D177E, T200A, Q207E, V245Q  
>SNA3-234| codons 1-272
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKNKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEIEI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, G16GE, K20I, M36I, R41K, L63S, H69K, K70R, L89I  
>SNA3-234| codons 1-99
PQITLWQRPLVTARIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013