<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-215 SNA3-215 Senegal 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35K, M36I, N37E, R41K, L63A, H69K, K70R, V82I, L89M  
>SNA3-215| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEKIELPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103NS, G190A   K11KR, T27TS, V35T, K64R, K122P, D123E, S162A, K173Q, Q174K, D177E, V179I, T200A, Q207E  
>SNA3-215| codons 1-238
PISPIETVPVRLKPGMDGPKVKQWPLSEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DPEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRQKNPEIII
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013