<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215F V75I Y181C A98G V35T, E36D, T39A, V60I, I132L, I135L, S162A, K173T, Q174K, D177E, T200A, Q207E, H221Y, V245K, K249Q, A272P, K275KR, R284K, T286A, E291D, V292I, I293V, P294A, S322T Y183Y*
>SNA3-127| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTLPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
CQ*VDDLYVGSDLEIGQHRAKIEELREHLWRWGFFTPDKKYQKEPPFLWMGYELHPDKWT
VQPIKLPEQDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLKGAKALTDIVALTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, L19P, K20I, M36I, R41K, K43R, H69K, K70R, L89M  
>SNA3-127| codons 1-99
PQITLWQRPVVTVKIGGQPIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013