<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-196 SNA3-196 Senegal 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190A   V21I, V35T, T39A, V60I, D123E, I135V, S162A, K173T, Q174K, D177E, T200A, Q207R, R211E  
>SNA3-196| codons 1-238
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVASDLEIGQHRAKIEELRRHLLEWGFTTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15IV, K20I, E35N, M36I, R41K, L63S, I64M, H69K, L89M  
>SNA3-196| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QISMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013