<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC|AZT|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215Y     A98G, Y188YF E6K, V35T, K49R, V60I, S68G, V90I, K122E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K G45A
>SNA3-340| codons 1-238
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEAKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYVDDLFVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, L19P, K20I, M36I, N37D, R41K, K43R, L63P, H69K, I72M, L89M  
>SNA3-340| codons 1-99
PQITLWQRPVVTVKIGGQPIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAMGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013