<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-276 SNA3-276 Senegal 2009 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 EFV|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   V21I, V35T, T39S, V60I, K122E, D123S, S162A, K173T, Q174K, D177E, I178V, T200A, Q207E  
>SNA3-276| codons 1-238
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEVVI
YQYVDDLLVGSDLEIGQHRAKIEELREHLLRWGFFTPDEKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, M36I, R41K, L63V, L89M  
>SNA3-276| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013