<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-248 SNA3-248 Senegal 2010 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, K14R, G17E, K20I, M36I, N37D, L63H, H69K, K70KR, L89I  
>SNA3-248| codons 1-99
PQITLWQRPLITVRIGEQLIEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGKRAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K103N   V35T, E36D, T39L, S48T, V60I, V90I, I135T, A158S, S162A, T165L, K173T, Q174K, D177E, T200A, I202V, Q207E  
>SNA3-248| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQASMLKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013