<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SNA3-391 SNA3-391 Senegal 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    G190A E138K V21I, V35T, E36D, T39M, K49R, V60I, V90I, K122E, S162A, K173T, Q174K, D177E, I178M, T200E, E204K, Q207E, R211K  
>SNA3-391| codons 1-238
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTDICMEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVASDLEIGQHREKIEKLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, L19P, K20I, A22V, M36T, R41K, L63P, H69K, L89I  
>SNA3-391| codons 1-99
PQITLWQRPLVTAKIGGQPIEVLLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Kebe, K High rate of antiretroviral drug resistance mutations in HIV type 1 infected Senegalese children in virological failure on first-line treatment according to the World Health Organization guidelines. ARHR, 2013