<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT+DDI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y188L   K64H, T69N, V118VI, D121E, S162C, T200TA, Q207K, R211NS, W212WC G196GW
>HNDR2512| codons 1-225
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIHKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
EKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIWQHRAKIEELRKHLWSCGFYTPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, R41K, K43KR, L63P, A71V, I72E, V77I, I93L  
>HNDR2512| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGHKVEGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Liu, J Drug resistance and HCV coinfection in former blood donors infected with HIV type 1 in China. ARHR, 2011