<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1161 CA2640 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+ DDC 52
3 AZT+ DDI 52
4 D4T+ DDI 52
5 AZT+ DDC 52
6 3TC+ AZT+ DDC 43
7 3TC+ AZT+ D4T+ SQV 17
8 3TC+ AZT+ D4T+ RTV+ SQV 26
9 3TC+ AZT+ D4T+ DLV+ IDV 25
10 3TC+ D4T+ NFV 26
11 D4T+ DDI 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67~, K70R, L74I, M184V, T215F T69G, K219Q K103N   E6D, K20R, T27X, T39N, K43E, K102R, D123E, K166R, D177E, V179I, G196X, T200I, Q207E, F214L, V245K, A272P, K277R  
>CA2640| codons 1-290
PISPIDTVPVKLKPGMDGPRVKQWPLXEEKIKALVEICNELEEEGKISKIGPENPYNTPV
FAIKKK~SGRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIII
YQYVDDLYVGSDLEIXQHRIKIEELREHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VAFS, L90M F53L L10I, E34EQ, I62V, L63A, A71V  
>CA2639| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKMIGGIGGLVKVRQYD
QVAIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005