<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KI-575 KI-575 Japan 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    A23V, L28I, V201I, I203M, K215N D286N
>KI-575| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMVSDFNIPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQNQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQNED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G16E, R41K, R57K, I62V, L63T, A71V, I93L  
>KI-575| codons 1-99
PQITLWQRPIVTVRIEGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
QVTIEICGHKVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, K103R, I135L, S162C, T200A, Q207H, R211K, A272P, K277R, E297V, I326V, I329V, Q334L, R358K, K385R, T403M, R463K, H483N  
>KI-575| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRHHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTVEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGLGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGRTPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGKQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Chikata, T Host-specific adaptation of HIV-1 subtype B in the Japanese population. J Virol, 2014