<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1159 CA2636 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 DDI 26
3 D4T 18
4 AZT+D4T+IDV 26
5 AZT+DDI+NVP+RTV+SQV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106VA, Y181YC   V35L, E79ED, V179I, G196E, T200A, E203K, Q207E, E248D, S268X  
>CA2636| codons 1-269
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRDLNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIEQHRAKIKELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWAXQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V   L10Y, I15V, D60E, L63P, K70T, T74A, L89M  
>CA2635| codons 1-99
PQITLWQRPYVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QIPIEICGHTAIGAVLVGPTPANVIGRNMLTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005