<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KI-630 KI-630 Japan 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, D41N, I72V, I84M, T112V, T124TN, F139Y, M154L, S195C, I203M  
>KI-630| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIVASCNKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIKQEYGIPYNPQSQGVVESLNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYCAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I15V, L19I, E35D, R41K, R57K, L63T, A71T, I72T, I93L  
>KI-630| codons 1-99
PQITLWQRPLVAIKVGGQIKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGHKTTGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, I135T, T200A, R211G, I293V, E297AT, I329V, F346Y, R356K, M357T, V435I, K454R, R461K, H483Y  
>KI-630| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPYKNLKTGKYAKTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGRAGYVTDKGRQKVVSLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Chikata, T Host-specific adaptation of HIV-1 subtype B in the Japanese population. J Virol, 2014