<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1157 CA2631 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+ DDC 247
3 DDI 30
4 D4T 8
5 3TC+ D4T 8
6 3TC+ D4T+ SQV 13
7 3TC+ D4T+ IDV 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, L90M G73S L10I, I13V, K14R, N37D, L63P, A71AT, I72V, V77I  
>CA2631| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKTVSTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y A62AV, K219KR     K20R, V35I, K43E, E44A, V118I, K122E, I135T, H208HY, R211K, F214FL, L228H, A272P, K277R  
>CA2632| codons 1-287
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FVIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGLYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTK

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005