<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KI-580 KI-580 Japan 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, V32I, S39C, L74I, L101I, S119T, I203M, T206S, K211KR, K215N  
>KI-580| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIIAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDMIASDIQTRELQNQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K20R, M36I, R57RK, L63P, C67CY, K70T, A71AV, I72T, I93L  
>KI-580| codons 1-99
PQITLWQRPLVPIKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QIPIEIYGHTVTGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, I135V, T200I, D237DN, K238KR, A272S, K281R, T286A, S322T, I341V, M357T, A360T, V435E, E449D, D460N, R461K, K465R, E546D  
>KI-580| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPNRWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCRLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQGQWTYQVYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRDTKLGKAGYVTNKGRQRVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNDQVDKLVSAGIRKVL

References
Author Title Citation
Chikata, T Host-specific adaptation of HIV-1 subtype B in the Japanese population. J Virol, 2014