<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1155 CA2627 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+PI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N     V35I, K43Q, E44D, V118I, D121H, K122E, I135T, D177E, G196E, H208Y, R211K, V245K  
>CA2627| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M F53L L10I, V11X, T12K, I13IV, G16X, L19V, N37S, R41K, Q61QH, L63P, A71V  
>CA2628| codons 1-99
PQITLWQRPIXKVKIXGQVKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGLVKVRQYD
HIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001